| 产品详情 |
| Edit |   |
| Antigenic Specificity | SRp55 |
| Clone | 5G6 |
| Host Species | Mouse |
| Reactive Species | human |
| Isotype | IgG2b kappa |
| Format | IgG purified, no preservative |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SRp55 Antibody (5G6) from Novus Biologicals is a mouse monoclonal antibody to SRp55. This antibody reacts with human. The SRp55 Antibody (5G6) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. |
| Immunogen | SFRS6 (NP_006266, 1 a.a. - 75 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPRVYIGRLSYNVREKDIQRFFSGYGRLLEVDLKNGYGFVEFEDSRDADDAVYELNGKELCGERVIVEHARGPRR |
| Other Names | B52, FLJ08061, pre-mRNA splicing factor SRP55, Pre-mRNA-splicing factor SRP55, serine/arginine-rich splicing factor 6, SFRS6, Splicing factor, arginine/serine-rich 6MGC5045, splicing factor, arginine/serine-rich, 55 kDa, SR splicing factor 6, SRP55arginine/serine-rich splicing factor 6 |
| Gene, Accession # | SRSF6, Gene ID: 6431, Accession: NP_006266, SwissProt: NP_006266 |
| Catalog # | H00006431-M02 |
| Price | |
| Order / More Info | SRp55 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|