| Edit |   |
|---|
| Antigenic Specificity | SRP68 |
|---|
| Clone | 3A3 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. Antibody reactivity Against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. It has been used for IF. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SRP68 Antibody (3A3) from Novus Biologicals is a mouse monoclonal antibody to SRP68. This antibody reacts with human. The SRP68 Antibody (3A3) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. |
|---|
| Immunogen | SRP68 (NP_055045.2, 531 a.a. - 627 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AILDANDAHQTETSSSQVKDNKPLVERFETFCLDPSLVTKQANLVHFPPGFQPIPCKPLFFDLALNHVAFPPLEDKLEQKTKSGLTGYIKGIFGFRS |
|---|
| Other Names | signal recognition particle 68 kDa protein, signal recognition particle 68kD, signal recognition particle 68kDa |
|---|
| Gene, Accession # | SRP68, Gene ID: 6730, Accession: NP_055045, SwissProt: NP_055045 |
|---|
| Catalog # | H00006730-M03 |
|---|
| Price | |
|---|
| Order / More Info | SRP68 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|