| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SP-D |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SP-D Antibody from Novus Biologicals is a rabbit polyclonal antibody to SP-D. This antibody reacts with human. The SP-D Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human SP-D antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: EPNDDGGSEDCVEIFTNGKWNDRACGEKRLVVCEF |
|---|
| Other Names | COLEC7collectin-7, collectin 7, Collectin-7, Lung surfactant protein D, PSPD, PSP-D, SFTP4pulmonary surfactant-associated protein D, SP-Dpulmonary surfactant apoprotein, surfactant protein D, surfactant, pulmonary-associated protein D, surfactant-associated protein, pulmonary 4 |
|---|
| Gene, Accession # | SFTPD, Gene ID: 6441, Accession: P35247, SwissProt: P35247 |
|---|
| Catalog # | NBP2-38803 |
|---|
| Price | |
|---|
| Order / More Info | SP-D Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|