| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CARD11/CARMA1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CARD11/CARMA1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CARD11/CARMA1. This antibody reacts with human. The CARD11/CARMA1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human CARD11/CARMA1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: ELEEKNDEMRIEMVRREACIVNLESKLRRLSKDSNNLDQSLPRNLPVTIISQDFGDASPRTNGQEADDSSTSEESPEDSKYFLPYHP |
|---|
| Other Names | BIMP3card-maguk protein 1, CARD-containing MAGUK protein 1, Carma 1, CARMA1bcl10-interacting maguk protein 3, caspase recruitment domain family, member 11, caspase recruitment domain-containing protein 11, MGC133069 |
|---|
| Gene, Accession # | CARD11, Gene ID: 84433 |
|---|
| Catalog # | NBP2-49067 |
|---|
| Price | |
|---|
| Order / More Info | CARD11/CARMA1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|