| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | E2F-1 |
|---|
| Clone | 2E10 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Proximity Ligation Assay. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The E2F-1 Antibody (2E10) from Novus Biologicals is a mouse monoclonal antibody to E2F-1. This antibody reacts with human. The E2F-1 Antibody (2E10) has been validated for the following applications: Western Blot, ELISA, Proximity Ligation Assay. |
|---|
| Immunogen | E2F1 (NP_005216.1 348 a.a. - 437 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QSLLSLEQEPLLSRMGSLRAPVDEDRLSPLVAADSLLEHVREDFSGLLPEEFISLSPPHEALDYHFGLEEGEGIRDLFDCDFGDLTPLDF |
|---|
| Other Names | E2F transcription factor 1, E2F-1, PBR3, PRB-binding protein E2F-1, RBAP1, RBAP-1, RBBP3, RBBP-3, RBP3, Retinoblastoma-associated protein 1, Retinoblastoma-binding protein 3, transcription factor E2F1 |
|---|
| Gene, Accession # | E2F1, Gene ID: 1869, Accession: NP_005216, SwissProt: NP_005216 |
|---|
| Catalog # | H00001869-M01 |
|---|
| Price | |
|---|
| Order / More Info | E2F-1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|