| Edit |   |
|---|
| Antigenic Specificity | ORMDL3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ORMDL3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ORMDL3. This antibody reacts with human. The ORMDL3 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | The immunogen for this antibody is ORMDL3 - N-terminal region. Peptide sequence GTAHSEVNPNTRVMNSRGIWLSYVLAIGLLHIVLLSIPFVSVPVVWTLTN. |
|---|
| Other Names | ORM1 (S. cerevisiae)-like 3, ORM1-like 3 (S. cerevisiae), ORM1-like protein 3 |
|---|
| Gene, Accession # | ORMDL3, Gene ID: 94103, Accession: NP_644809, SwissProt: NP_644809 |
|---|
| Catalog # | NBP1-98511 |
|---|
| Price | |
|---|
| Order / More Info | ORMDL3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|