| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Ornithine Carbamoyltransferase |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Ornithine Carbamoyltransferase Antibody from Novus Biologicals is a rabbit polyclonal antibody to Ornithine Carbamoyltransferase. This antibody reacts with human. The Ornithine Carbamoyltransferase Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptides corresponding to OTC(ornithine carbamoyltransferase) The peptide sequence was selected from the N terminal of OTC. Peptide sequence AFRNGHNFMVRNFRCGQPLQNKVQLKGRDLLTLKNFTGEEIKYMLWLSAD. |
|---|
| Other Names | EC 2.1.3, EC 2.1.3.3, MGC129967, MGC129968, MGC138856, OCTD, ornithine carbamoyltransferase, ornithine carbamoyltransferase, mitochondrial, Ornithine transcarbamylase, OTCase |
|---|
| Gene, Accession # | OTC, Gene ID: 5009, Accession: P00480, SwissProt: P00480 |
|---|
| Catalog # | NBP1-54934 |
|---|
| Price | |
|---|
| Order / More Info | Ornithine Carbamoyltransferase Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|