| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TRF-1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TRF-1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TRF-1. This antibody reacts with human. The TRF-1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human TRF-1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FLSKLQHGTQQQDLNKKERRVGTLQSTKKKKESRRATESRIPVSKSQPVTPE |
|---|
| Other Names | NIMA-interacting protein 2, PIN2hTRF1-AS, Telomeric protein Pin2/TRF1, telomeric repeat binding factor (NIMA-interacting) 1, telomeric repeat binding factor 1, telomeric repeat binding protein 1, telomeric repeat-binding factor 1, TERF1, TRBF1, TRF1FLJ41416, TRFt-TRF1, TTAGGG repeat-binding factor 1 |
|---|
| Gene, Accession # | TERF1, Gene ID: 7013 |
|---|
| Catalog # | NBP2-57285 |
|---|
| Price | |
|---|
| Order / More Info | TRF-1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|