| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CXCR4 |
|---|
| Clone | 1F8 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 kappa |
|---|
| Format | ascites, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CXCR4 Antibody (1F8) from Novus Biologicals is a mouse monoclonal antibody to CXCR4. This antibody reacts with human. The CXCR4 Antibody (1F8) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | CXCR4 (AAH20968, 1 a.a. - 46 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYS |
|---|
| Other Names | CD184, chemokine (C-X-C motif) receptor 4, chemokine (C-X-C motif), receptor 4 (fusin), C-X-C chemokine receptor type 4, CXC-R4, CXCR-4, D2S201ESDF-1 receptor, FB22, Fusin, HM89NPYRL, HSY3RR, LAP3, LCR1, LESTRCD184 antigen, Leukocyte-derived seven transmembrane domain receptor, leukocyte-derived seven-transmembrane-domain receptor, lipopolysaccharide-associated protein 3, neuropeptide Y receptor Y3, NPY3RWHIM, NPYR, NPYY3R, seven transmembrane helix receptor, seven-transmembrane-segment receptor, spleen, Stromal cell-derived factor 1 receptor |
|---|
| Gene, Accession # | CXCR4, Gene ID: 7852 |
|---|
| Catalog # | H00007852-M02 |
|---|
| Price | |
|---|
| Order / More Info | CXCR4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 24556683 |
|---|
| 产品资料 |
|
|