| 产品详情 |
| Edit |   |
| Antigenic Specificity | POMGNT1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The POMGNT1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to POMGNT1. This antibody reacts with human. The POMGNT1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human POMGNT1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LFLNMVAPGRVLICTVKDEGSFHLKDTAKALLRSLGSQAGPALGWRDTWAFVGRKGGPVFGEKHSKSPALSSWGDPVLLK |
| Other Names | DKFZp761B182, EC 2.4.1, EC 2.4.1.-, EC 2.4.1.101, FLJ20277, GnT I.2, MDDGA3, MDDGB3, MDDGC3, MEB, MGAT1.2GNTI.2, POMGnT1, protein O-linked mannose beta1,2-N-acetylglucosaminyltransferase, protein O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1, UDP-GlcNAc:alpha-D-mannoside beta-1,2-N-acetylglucosaminyltransferase I.2 |
| Gene, Accession # | POMGNT1, Gene ID: 55624 |
| Catalog # | NBP1-82193 |
| Price | |
| Order / More Info | POMGNT1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|