| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Cav1.4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. Recommended conditions for IHC,Retrieval method: HIER pH6 |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Cav1.4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Cav1.4. This antibody reacts with human. The Cav1.4 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SCEDLPIPGTYHRGRNSGPNRAQGSWATPPQRGRLLYAPLLLVEEGAAGEGYLGRSSGPLRTFTCLHVPGTHSDPSH |
|---|
| Other Names | AIED, CACNAF1, calcium channel, voltage-dependent, L type, alpha 1F subunit, Cav1.4, Cav1.4alpha1, COD4, CORDX, CORDX3CSNB2, CSNB2AAland island eye disease (Forsius-Eriksson ocular albinism, ocular albinismtype 2), CSNBX2, JM8, JMC8, OA2COD3, voltage-dependent L-type calcium channel subunit alpha-1F, Voltage-gated calcium channel subunit alpha Cav1.4 |
|---|
| Gene, Accession # | CACNA1F, Gene ID: 778 |
|---|
| Catalog # | NBP2-68869 |
|---|
| Price | |
|---|
| Order / More Info | Cav1.4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|