| Edit |   |
|---|
| Antigenic Specificity | PMM1/Phosphomannomutase 1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PMM1/Phosphomannomutase 1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PMM1/Phosphomannomutase 1. This antibody reacts with human. The PMM1/Phosphomannomutase 1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to PMM1/Phosphomannomutase 1. The peptide sequence was selected from the N terminal of PMM1/Phosphomannomutase 1. Peptide sequence MAVTAQAARRKERVLCLFDVDGTLTPARQKIDPEVAAFLQKLRSRVQIGV. |
|---|
| Other Names | brain glucose-1,6-bisphosphatase, EC 5.4.2.8, phosphomannomutase 1, PMM 1, PMMH22, PMMH-22, Sec53 |
|---|
| Gene, Accession # | PMM1, Gene ID: 5372, Accession: Q92871, SwissProt: Q92871 |
|---|
| Catalog # | NBP1-55475-20ul |
|---|
| Price | |
|---|
| Order / More Info | PMM1/Phosphomannomutase 1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|