| Edit |   |
|---|
| Antigenic Specificity | PMM2/Phosphomannomutase 2 |
|---|
| Clone | 2E9 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2b kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PMM2/Phosphomannomutase 2 Antibody (2E9) from Novus Biologicals is a mouse monoclonal antibody to PMM2/Phosphomannomutase 2. This antibody reacts with human. The PMM2/Phosphomannomutase 2 Antibody (2E9) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | PMM2 (NP_000294, 47 a.a. - 111 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SDFEKVQEQLGNDVVEKYDYVFPENGLVAYKDGKLLCRQNIQSHLGEALIQDLINYCLSYIAKIK |
|---|
| Other Names | CDG1, CDG1A, CDGS, EC 5.4.2.8, phosphomannomutase 2, PMM 2 |
|---|
| Gene, Accession # | PMM2, Gene ID: 5373, Accession: NP_000294, SwissProt: NP_000294 |
|---|
| Catalog # | H00005373-M01 |
|---|
| Price | |
|---|
| Order / More Info | PMM2/Phosphomannomutase 2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|