| Edit |   |
|---|
| Antigenic Specificity | p33MONOX |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The p33MONOX Antibody from Novus Biologicals is a rabbit polyclonal antibody to p33MONOX. This antibody reacts with human. The p33MONOX Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to KIAA1191(KIAA1191) The peptide sequence was selected from the middle region of KIAA1191. Peptide sequence TPHSSPKQRPRGWFTSGSSTALPGPNPSTMDSGSGDKDRNLSDKWSLFGP. |
|---|
| Other Names | Brain-derived rescue factor p60MONOX, FLJ21022, hypothetical protein LOC57179, KIAA1191, p60MONOX |
|---|
| Gene, Accession # | KIAA1191, Gene ID: 57179, Accession: Q96A73, SwissProt: Q96A73 |
|---|
| Catalog # | NBP1-56834-20ul |
|---|
| Price | |
|---|
| Order / More Info | p33MONOX Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|