| Edit |   |
| Antigenic Specificity | p33MONOX |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The p33MONOX Antibody from Novus Biologicals is a rabbit polyclonal antibody to p33MONOX. This antibody reacts with human. The p33MONOX Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to KIAA1191(KIAA1191) The peptide sequence was selected from the middle region of KIAA1191. Peptide sequence TKYLRVAEALHKLKLQSGEVTKEERQPASAQSTPSTTPHSSPKQRPRGWF. |
| Other Names | Brain-derived rescue factor p60MONOX, FLJ21022, hypothetical protein LOC57179, KIAA1191, p60MONOX |
| Gene, Accession # | KIAA1191, Gene ID: 57179, Accession: Q96A73, SwissProt: Q96A73 |
| Catalog # | NBP1-56955 |
| Price | |
| Order / More Info | p33MONOX Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |