| Edit |   |
|---|
| Antigenic Specificity | SRP68 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SRP68 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SRP68. This antibody reacts with human. The SRP68 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to SRP68(signal recognition particle 68kDa) The peptide sequence was selected from the N terminal of SRP68. Peptide sequence EENKENERPSAGSKANKEFGDSLSLEILQIIKESQQQHGLRHGDFQRYRG. |
|---|
| Other Names | signal recognition particle 68 kDa protein, signal recognition particle 68kD, signal recognition particle 68kDa |
|---|
| Gene, Accession # | SRP68, Gene ID: 6730, Accession: Q9UHB9, SwissProt: Q9UHB9 |
|---|
| Catalog # | NBP1-57137 |
|---|
| Price | |
|---|
| Order / More Info | SRP68 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|