| Edit |   |
| Antigenic Specificity | GPR27 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The GPR27 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GPR27. This antibody reacts with human. The GPR27 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to GPR27 (G protein-coupled receptor 27). The peptide sequence was selected form the middle region of GPR27. Peptide sequence AVTLLFLLLWGPYVVASYLRVLVRPGAVPQAYLTASVWLTFAQAGINPVV. |
| Other Names | G protein-coupled receptor 27, probable G-protein coupled receptor 27, SREB1Super conserved receptor expressed in brain 1 |
| Gene, Accession # | GPR27, Gene ID: 2850, Accession: Q9NS67, SwissProt: Q9NS67 |
| Catalog # | NBP1-62485-20ul |
| Price | |
| Order / More Info | GPR27 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |