| Edit |   |
|---|
| Antigenic Specificity | GPR27 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GPR27 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GPR27. This antibody reacts with human. The GPR27 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to GPR27 (G protein-coupled receptor 27). The peptide sequence was selected form the middle region of GPR27. Peptide sequence AVTLLFLLLWGPYVVASYLRVLVRPGAVPQAYLTASVWLTFAQAGINPVV. |
|---|
| Other Names | G protein-coupled receptor 27, probable G-protein coupled receptor 27, SREB1Super conserved receptor expressed in brain 1 |
|---|
| Gene, Accession # | GPR27, Gene ID: 2850, Accession: Q9NS67, SwissProt: Q9NS67 |
|---|
| Catalog # | NBP1-62485 |
|---|
| Price | |
|---|
| Order / More Info | GPR27 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|