| Edit |   |
| Antigenic Specificity | GPR3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The GPR3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GPR3. This antibody reacts with human. The GPR3 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | The immunogen for this antibody is GPR3 - C-terminal region. Peptide sequence PPLYTYLTLLPATYNSMINPIIYAFRNQDVQKVLWAVCCCCSSSKIPFRS. |
| Other Names | ACCA, G protein-coupled receptor 3 |
| Gene, Accession # | GPR3, Gene ID: 2827, Accession: NP_005272, SwissProt: NP_005272 |
| Catalog # | NBP1-98282-20ul |
| Price | |
| Order / More Info | GPR3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |