| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ARH |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ARH Antibody from Novus Biologicals is a rabbit polyclonal antibody to ARH. This antibody reacts with human. The ARH Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ARH antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MAQAVTLTVAQAFKVAFEFWQVSKEEKEKRDKASQEGGDVLGARQDCTPSLKSLVATGNLLDL |
|---|
| Other Names | ARH1, ARH2, ARHAutosomal recessive hypercholesterolemia protein, DKFZp586D0624, FHCB1ARH1, FHCB2LDL receptor adaptor protein, low density lipoprotein receptor adapter protein 1, low density lipoprotein receptor adaptor protein 1, MGC34705 |
|---|
| Gene, Accession # | LDLRAP1, Gene ID: 26119 |
|---|
| Catalog # | NBP2-48959 |
|---|
| Price | |
|---|
| Order / More Info | ARH Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|