| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PDK2 |
|---|
| Clone | 5F8 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | Protein A purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunohistochemistry-Paraffin. WB usage on cell lysate and recombinant protein reported in scientific literature (PMID: 22123926). |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PDK2 Antibody (5F8) from Novus Biologicals is a mouse monoclonal antibody to PDK2. This antibody reacts with human. The PDK2 Antibody (5F8) has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | PDK2 (AAH05811 187 a.a. - 276 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HIGSIDPNCNVSEVVKDAYDMAKLLCDKYYMASPDLEIQEINAANSKQPIHMVYVPSHLYHMLFELFKNAMRATVESHESSLILPPIKVM |
|---|
| Other Names | EC 2.7.11, EC 2.7.11.2, lipoamide, kinase isozyme 2, mitochondrial, Pyruvate dehydrogenase kinase isoform 2, pyruvate dehydrogenase kinase, isoenzyme 2, pyruvate dehydrogenase kinase, isozyme 2 |
|---|
| Gene, Accession # | PDK2, Gene ID: 5164, Accession: AAH05811, SwissProt: AAH05811 |
|---|
| Catalog # | H00005164-M02 |
|---|
| Price | |
|---|
| Order / More Info | PDK2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 22123926 |
|---|
| 产品资料 |
|
|