| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PDK4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PDK4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PDK4. This antibody reacts with human. The PDK4 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human PDK4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: QSLMDLVEFHEKSPDDQKALSDFVDTLIKVRNRHHNVVPTMAQG |
|---|
| Other Names | [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 4, mitochondrial, EC 2.7.11, EC 2.7.11.2, FLJ40832, Pyruvate dehydrogenase kinase isoform 4, pyruvate dehydrogenase kinase, isoenzyme 4, pyruvate dehydrogenase kinase, isozyme 4, pyruvate dehydrogenase, lipoamide, kinase isozyme 4, mitochondrial |
|---|
| Gene, Accession # | PDK4, Gene ID: 5166 |
|---|
| Catalog # | NBP2-49235 |
|---|
| Price | |
|---|
| Order / More Info | PDK4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|