| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | OAS2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The OAS2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to OAS2. This antibody reacts with human. The OAS2 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human OAS2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TLVLFFSDLKQFQDQKRSQRDILDKTGDKLKFCLFTKWLKNNFEIQKSLDGFTIQVFTKNQRISFEVLAAFNALSLNDNPSPWIYRELKRSLDKTNASPGEFAVCFTELQQK |
|---|
| Other Names | (2-5')oligo(A) synthase 2, (2'-5')oligo(A) synthetase 2, (2-5')oligo(A) synthetase 2, 2'5' oligoadenylate synthetase 2, 2-5A synthase 2, 2-5A synthetase 2, 2'-5'-oligoadenylate synthase 2, 2'-5'-oligoadenylate synthetase 2 (69-71 kD), 2'-5'-oligoadenylate synthetase 2, 69/71kDa, EC 2.7.7, EC 2.7.7.-, MGC78578, p69 OAS/ p71 OAS, p69OAS/ p71OAS |
|---|
| Gene, Accession # | OAS2, Gene ID: 4939 |
|---|
| Catalog # | NBP2-58756 |
|---|
| Price | |
|---|
| Order / More Info | OAS2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|