| Edit |   |
| Antigenic Specificity | VSIG8 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The VSIG8 Antibody from Novus Biologicals is a rabbit polyclonal antibody to VSIG8. This antibody reacts with human. The VSIG8 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to VSIG8(V-set and immunoglobulin domain containing 8) The peptide sequence was selected from the N terminal of VSIG8. Peptide sequence HRENVFLSYQDKRINHGSLPHLQQRVRFAASDPSQYDASINLMNLQVSDT. |
| Other Names | V-set and immunoglobulin domain containing 8 |
| Gene, Accession # | VSIG8, Gene ID: 391123 |
| Catalog # | NBP1-70742 |
| Price | |
| Order / More Info | VSIG8 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |