| 产品详情 |
| Edit |   |
| Antigenic Specificity | CX3CR1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CX3CR1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CX3CR1. This antibody reacts with human. The CX3CR1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human CX3CR1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LEAFKLADLDFRKSSLASGWRMASGAFTMDQFPESVTENFEYDDLAEACYIGDIVVFGTVF |
| Other Names | Beta chemokine receptor-like 1, CCRL1, chemokine (C-C) receptor-like 1, chemokine (C-X3-C motif) receptor 1, chemokine (C-X3-C) receptor 1, CMKBRL1, CMK-BRL1, CMK-BRL-1, CMKDR1, CX3C chemokine receptor 1, Fractalkine receptor, G protein-coupled receptor 13, GPR13G-protein coupled receptor 13, GPRV28, V28C-X3-C CKR-1 |
| Gene, Accession # | CX3CR1, Gene ID: 1524, Accession: P49238, SwissProt: P49238 |
| Catalog # | NBP2-38554 |
| Price | |
| Order / More Info | CX3CR1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|