| Edit |   |
| Antigenic Specificity | Polypeptide GalNac Transferase 3/GALNT3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Polypeptide GalNac Transferase 3/GALNT3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Polypeptide GalNac Transferase 3/GALNT3. This antibody reacts with rat. The Polypeptide GalNac Transferase 3/GALNT3 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to the N terminal of Galnt3. Immunizing peptide sequence PERPCLQGYYTAAELKPVLDRPPQDSNAPGASGKPFKITHLSPEEQKEKE. |
| Other Names | EC 2.4.1.41, GalNAc transferase 3, GalNAc-T3DKFZp686C10199, HFTCMGC61909, HHSPolypeptide GalNAc transferase 3, polypeptide GalNAc-transferase T3, polypeptide N-acetylgalactosaminyltransferase 3, pp-GaNTase 3, Protein-UDP acetylgalactosaminyltransferase 3, UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 3, UDP-N-acetyl-alpha-D-galactosamine:polypeptideN-acetylgalactosaminyltransferase 3 (GalNAc-T3) |
| Gene, Accession # | GALNT3, Gene ID: 2591, Accession: Q3T1J4 |
| Catalog # | NBP1-74244 |
| Price | |
| Order / More Info | Polypeptide GalNac Transferase 3/GALNT3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |