| Edit |   |
|---|
| Antigenic Specificity | Polypeptide GalNac Transferase 4/GALNT4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Polypeptide GalNac Transferase 4/GALNT4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Polypeptide GalNac Transferase 4/GALNT4. This antibody reacts with human. The Polypeptide GalNac Transferase 4/GALNT4 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human Polypeptide GalNac Transferase 4/GALNT4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: IRFNSVTELCAEVPEQKNYVGMQNCPKDGFPVPANIIWHFKEDGTIFHPHSGLCLSAYRTPEGRPDVQMRTCDA |
|---|
| Other Names | EC 2.4.1.41, FLJ93314, GalNAc-T4, GALNACT4, Polypeptide GalNAc transferase 4, polypeptide N-acetylgalactosaminyltransferase 4, pp-GaNTase 4, Protein-UDP acetylgalactosaminyltransferase 4, UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 4, UDP-N-acetyl-alpha-D-galactosamine:polypeptideN-acetylgalactosaminyltransferase 4 (GalNAc-T4) |
|---|
| Gene, Accession # | GALNT4, Gene ID: 8693 |
|---|
| Catalog # | NBP2-55959 |
|---|
| Price | |
|---|
| Order / More Info | Polypeptide GalNac Transferase 4/GALNT4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|