| 产品详情 |
| Edit |   |
| Antigenic Specificity | Polypeptide GalNac Transferase 7/GALNT7 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Polypeptide GalNac Transferase 7/GALNT7 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Polypeptide GalNac Transferase 7/GALNT7. This antibody reacts with human. The Polypeptide GalNac Transferase 7/GALNT7 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Polypeptide GalNac Transferase 7/GALNT7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GDSQKDIMQRQYLTFKPQTFTYHDPVLRPGILGNFEPKEPEPPGVVGGPGEKAKPLVLGPEFKRAI |
| Other Names | EC 2.4.1, EC 2.4.1.-, EC 2.4.1.37, EC 2.4.1.41, GalNAcT7, GalNAc-T7, N-acetylgalactosaminyltransferase 7, Polypeptide GalNAc transferase 7, polypeptide N-acetylgalactosaminyltransferase 7, pp-GaNTase 7, Protein-UDP acetylgalactosaminyltransferase 7, UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 7, UDP-N-acetyl-alpha-D-galactosamine:polypeptideN-acetylgalactosaminyltransferase 7 (GalNAc-T7) |
| Gene, Accession # | GALNT7, Gene ID: 51809, Accession: Q86SF2, SwissProt: Q86SF2 |
| Catalog # | NBP2-39021 |
| Price | |
| Order / More Info | Polypeptide GalNac Transferase 7/GALNT7 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|