| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | POMC |
|---|
| Clone | 3E11 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The POMC Antibody (3E11) from Novus Biologicals is a mouse monoclonal antibody to POMC. This antibody reacts with human. The POMC Antibody (3E11) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | POMC (NP_000930 205 a.a. - 267 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LEHSLLVAAEKKDEGPYRMEHFRWGSPPKDKRYGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE |
|---|
| Other Names | ACTH, adrenocorticotropic hormone, adrenocorticotropin, alpha-melanocyte-stimulating hormone, alpha-MSH, beta-endorphin, beta-LPH, beta-melanocyte-stimulating hormone, beta-MSH, CLIP, corticotropin-like intermediary peptide, corticotropin-lipotropin, gamma-LPH, gamma-MSH, lipotropin beta, lipotropin gamma, LPH, melanotropin alpha, melanotropin beta, melanotropin gamma, met-enkephalin, MSH, NPP, POC, pro-ACTH-endorphin, proopiomelanocortin, pro-opiomelanocortin, proopiomelanocortin preproprotein |
|---|
| Gene, Accession # | POMC, Gene ID: 5443, Accession: NP_000930, SwissProt: NP_000930 |
|---|
| Catalog # | H00005443-M01 |
|---|
| Price | |
|---|
| Order / More Info | POMC Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|