| 产品详情 |
| Edit |   |
| Antigenic Specificity | PPAR gamma/NR1C3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PPAR gamma/NR1C3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PPAR gamma/NR1C3. This antibody reacts with human. The PPAR gamma/NR1C3 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human PPAR gamma/NR1C3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNKPHEEPSNSLMAIECRVC |
| Other Names | CIMT1, NR1C3GLM1, Nuclear receptor subfamily 1 group C member 3, peroxisome proliferator-activated receptor gamma, peroxisome proliferator-activated receptor gamma 1, PPAR gamma, PPARG1peroxisome proliferative activated receptor, gamma, PPARG2PPARgamma, PPAR-gamma |
| Gene, Accession # | PPARG, Gene ID: 5468 |
| Catalog # | NBP2-57833 |
| Price | |
| Order / More Info | PPAR gamma/NR1C3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|