| Edit |   |
| Antigenic Specificity | ZFP200 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified, no preservative |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ZFP200 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZFP200. This antibody reacts with human. The ZFP200 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the middle region of human ZNF200. Peptide sequence SRHEGIHIREKIFKCPECGKTFPKNEEFVLHLQSHEAERPYGCKKCGRRF. |
| Other Names | MGC45293, zinc finger protein 200, ZNFMF |
| Gene, Accession # | ZNF200, Gene ID: 7752, Accession: NP_003445, SwissProt: NP_003445 |
| Catalog # | NBP1-80301 |
| Price | |
| Order / More Info | ZFP200 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |