| Edit |   |
|---|
| Antigenic Specificity | KBTBD8 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The KBTBD8 Antibody from Novus Biologicals is a rabbit polyclonal antibody to KBTBD8. This antibody reacts with human. The KBTBD8 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the N terminal of human KBTBD8. Peptide sequence CHRNVLAAISPYFRSMFTSGLTESTQKEVRIVGVEAESMDLVLNYAYTSR. |
|---|
| Other Names | kelch repeat and BTB (POZ) domain containing 8, KIAA1842, TAKRP, T-cell activation kelch repeat protein |
|---|
| Gene, Accession # | KBTBD8, Gene ID: 84541, Accession: NP_115894, SwissProt: NP_115894 |
|---|
| Catalog # | NBP1-91502-20ul |
|---|
| Price | |
|---|
| Order / More Info | KBTBD8 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|