| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | KCC1/SLC12A4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The KCC1/SLC12A4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to KCC1/SLC12A4. This antibody reacts with human. The KCC1/SLC12A4 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human KCC1/SLC12A4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MPHFTVVPVDGPRRGDYDNLEGLSWVDYGERAELDDSDGHGNHRESSPFLSPLEASRGIDYYDRNL |
|---|
| Other Names | Electroneutral potassium-chloride cotransporter 1, Erythroid K-Cl cotransporter 1, FLJ17069, FLJ40489, hKCC1, KCC1erythroid K:Cl cotransporter, K-Cl cotransporter, potassium/chloride cotransporter 1, solute carrier family 12 (potassium/chloride transporters), member 4, solute carrier family 12 member 4 |
|---|
| Gene, Accession # | SLC12A4, Gene ID: 6560 |
|---|
| Catalog # | NBP1-83067 |
|---|
| Price | |
|---|
| Order / More Info | KCC1/SLC12A4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|