| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Dectin-1/CLEC7A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Dectin-1/CLEC7A Antibody from Novus Biologicals is a rabbit polyclonal antibody to Dectin-1/CLEC7A. This antibody reacts with human. The Dectin-1/CLEC7A Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human Dectin-1/CLEC7A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SNSGSNTLENGYFLSRNKENHSQPTQSSLEDSVTPTKAVKTTGVLSSPCP PNWIIYEKSCYLFSMSLNSWDGSKRQCWQLGSNL |
|---|
| Other Names | Beta-glucan receptor, BGR, CLECSF12DC-associated C-type lectin 1, C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamilymember 12, C-type lectin domain family 7 member A, C-type lectin domain family 7, member A, C-type lectin superfamily member 12, dectin-1, DECTIN1CANDF4, Dendritic cell-associated C-type lectin 1, dendritic cell-associated C-type lectin-1, hDectin-1, lectin-like receptor 1 |
|---|
| Gene, Accession # | CLEC7A, Gene ID: 64581 |
|---|
| Catalog # | NBP2-13845 |
|---|
| Price | |
|---|
| Order / More Info | Dectin-1/CLEC7A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|