| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NAT8L |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100 |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NAT8L Antibody from Novus Biologicals is a rabbit polyclonal antibody to NAT8L. This antibody reacts with human. The NAT8L Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:MADIEQYYMKPPGSCFWVAVLDGNVVGIVAARAHEEDNTVELLRMSVDSRFRGKGIAKALGRKVLE |
|---|
| Other Names | Camello-like protein 3, CML3, DKFZp434B0650, DKFZp566H184, EC 2.3.1.17, FLJ37478, Hcml3, MGC117272, NAA synthetase, N-acetyltransferase 8-like, N-acetyltransferase 8-like (GCN5-related, putative), N-acetyltransferase 8-like protein, NAT8-LIKE |
|---|
| Gene, Accession # | NAT8L, Gene ID: 339983 |
|---|
| Catalog # | NBP1-83479 |
|---|
| Price | |
|---|
| Order / More Info | NAT8L Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|