| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | epithelial Sodium Channel alpha |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The epithelial Sodium Channel alpha Antibody from Novus Biologicals is a rabbit polyclonal antibody to epithelial Sodium Channel alpha. This antibody reacts with human. The epithelial Sodium Channel alpha Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human epithelial Sodium Channel alpha antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RYPEIKEELEELDRITEQTLFDLYKYSSFTTLVAGSRSRRDLRGTLPHPLQRLRVPPPPHGARRARSVASSLRDNNPQVDWKDWKIGFQL |
|---|
| Other Names | alpha ENaC-2, alpha-ENaC, Alpha-NaCH, amiloride-sensitive epithelial sodium channel alpha subunit, amiloride-sensitive sodium channel subunit alpha, amiloride-sensitive sodium channel subunit alpha 2, BESC2, ENaCA, ENaCalpha, Epithelial Na(+) channel subunit alpha, FLJ21883, nasal epithelial sodium channel alpha subunit, Nonvoltage-gated sodium channel 1 subunit alpha, SCNEA, SCNN1, sodium channel, nonvoltage-gated 1 alpha |
|---|
| Gene, Accession # | SCNN1A, Gene ID: 6337 |
|---|
| Catalog # | NBP1-84846 |
|---|
| Price | |
|---|
| Order / More Info | epithelial Sodium Channel alpha Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|