| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ORC3L |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ORC3L Antibody from Novus Biologicals is a rabbit polyclonal antibody to ORC3L. This antibody reacts with human. The ORC3L Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human ORC3L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NNVTPYVVSLQAKDCPDMKHFLQKLISQLMDCCVDIKSKEEESVHVTQRKTHYSMDSLSSWYMTVTQKTDPKMLSKKRTTSSQWQSPPVVVILKD |
|---|
| Other Names | IMAGE50150, LAT, LATHEOorigin recognition complex, subunit 3-like (yeast), ORC3Lhomolog of latheo, Drosophila, origin recognition complex subunit 3, Origin recognition complex subunit Latheo, origin recognition complex, subunit 3, origin recognition complex, subunit 3 (yeast homolog)-like, origin recognition complex, subunit 3 honolog, origin recognition complex, subunit 3 honolog (yeast), origin recognition complex, subunit 3-like |
|---|
| Gene, Accession # | ORC3, Gene ID: 23595 |
|---|
| Catalog # | NBP2-55490 |
|---|
| Price | |
|---|
| Order / More Info | ORC3L Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|