| 产品详情 |
| Edit |   |
| Antigenic Specificity | ORC4L |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ORC4L Antibody from Novus Biologicals is a rabbit polyclonal antibody to ORC4L. This antibody reacts with human. The ORC4L Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human ORC4L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SRKSKSNSLIHTECLSQVQRILRERFCRQSPHSNLFGVQVQYKHLSELLKRTALHGESNSVLIIGPRGSGKTMLINHALKELMEIEEVSENVLQVHL |
| Other Names | HsORC4, ORC4LFLJ46668, ORC4P, origin recognition complex subunit 4, origin recognition complex, subunit 4, origin recognition complex, subunit 4 (yeast homolog)-like, origin recognition complex, subunit 4 homolog, origin recognition complex, subunit 4 homolog (S. cerevisiae), origin recognition complex, subunit 4-like, origin recognition complex, subunit 4-like (S. cerevisiae), origin recognition complex, subunit 4-like (yeast) |
| Gene, Accession # | ORC4, Gene ID: 5000 |
| Catalog # | NBP2-56938 |
| Price | |
| Order / More Info | ORC4L Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|