| 产品详情 |
| Edit |   |
| Antigenic Specificity | SH3PX1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SH3PX1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SH3PX1. This antibody reacts with human, mouse, rat. The SH3PX1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat SH3PX1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: YQGPATGDDDDWDEDWDGPKSSSYFKDSESADAGGAQRGNSRASSSSMKIPLNKFPGFAKPGTEQYLLAKQLAKPKEKIPIIVGDYGPMW |
| Other Names | MST155, MSTP155, Protein SDP1, SDP1, SH3 and PX domain-containing protein 1, SH3PX1WISP, SH3PXD3ASH3 and PX domain-containing protein SH3PX1, sorting nexin 9, sorting nexin-9, WiskSH3 and PX domain-containing protein 3A |
| Gene, Accession # | SNX9, Gene ID: 51429, Accession: Q9Y5X1 |
| Catalog # | NBP1-80777 |
| Price | |
| Order / More Info | SH3PX1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|