| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SP-B/Surfactant Protein B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SP-B/Surfactant Protein B Antibody from Novus Biologicals is a rabbit polyclonal antibody to SP-B/Surfactant Protein B. This antibody reacts with human. The SP-B/Surfactant Protein B Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human SP-B/Surfactant Protein B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: AWTTSSLACAQGPEFWCQSLEQALQCRALGHCLQEVWGHVGADDLCQECEDIVHILNKMAKEAIFQDTMRKFLEQECNVLPLKLLMPQCNQVLDDYFP |
|---|
| Other Names | 18 kDa pulmonary-surfactant protein, 6 kDa protein, PSP-B, pulmonary surfactant-associated protein B, Pulmonary surfactant-associated proteolipid SPL(Phe), SFTB3, SFTP3, SMDP1, SP-B surfactant, pulmonary-associated protein B, surfactant protein B |
|---|
| Gene, Accession # | SFTPB, Gene ID: 6439, Accession: P07988, SwissProt: P07988 |
|---|
| Catalog # | NBP2-33982 |
|---|
| Price | |
|---|
| Order / More Info | SP-B/Surfactant Protein B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|