| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SP-B/Surfactant Protein B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SP-B/Surfactant Protein B Antibody from Novus Biologicals is a rabbit polyclonal antibody to SP-B/Surfactant Protein B. This antibody reacts with human, mouse. The SP-B/Surfactant Protein B Antibody has been validated for the following applications: Western Blot, Immunohistochemistry. |
|---|
| Immunogen | Synthetic peptides corresponding to SFTPB(surfactant, pulmonary-associated protein B) The peptide sequence was selected from the middle region of SFTPB. Peptide sequence PGALQARPGPHTQDLSEQQFPIPLPYCWLCRALIKRIQAMIPKGALAVAV. |
|---|
| Other Names | 18 kDa pulmonary-surfactant protein, 6 kDa protein, PSP-B, pulmonary surfactant-associated protein B, Pulmonary surfactant-associated proteolipid SPL(Phe), SFTB3, SFTP3, SMDP1, SP-B surfactant, pulmonary-associated protein B, surfactant protein B |
|---|
| Gene, Accession # | SFTPB, Gene ID: 6439, Accession: B2RC55, SwissProt: B2RC55 |
|---|
| Catalog # | NBP1-57977 |
|---|
| Price | |
|---|
| Order / More Info | SP-B/Surfactant Protein B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 26092997 |
|---|
| 产品资料 |
|
|