| 产品详情 |
| Edit |   |
| Antigenic Specificity | SPC24 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SPC24 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SPC24. This antibody reacts with human. The SPC24 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human SPC24 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: ERQEKEVDEDTTVTIPSAVYVAQLYHQVSKIEWDYECEPGMVKGIHHGPSVAQPIHLDSTQLSRKFISDYLWSLV |
| Other Names | FLJ90806, hSpc24, kinetochore protein Spc24, SPBC24, SPC24, NDC80 kinetochore complex component, homolog (S. cerevisiae), spindle pole body component 24 homolog, spindle pole body component 24 homolog (S. cerevisiae) |
| Gene, Accession # | SPC24, Gene ID: 147841 |
| Catalog # | NBP2-47264 |
| Price | |
| Order / More Info | SPC24 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|