| 产品详情 |
| Edit |   |
| Antigenic Specificity | TRERF1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TRERF1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TRERF1. This antibody reacts with human. The TRERF1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human TRERF1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QGSGLFSNVLISGHGPGAHPQLPLTPLTPTPRVLLCRSNSIDGSNVTVTPGPGEQTVDVEPRINIGLRFQAEIPELQDISALAQDTHKATLVWKPWPELENHDLQQRVENLLNLCC |
| Other Names | BCAR2, Breast cancer estrogen resistance 2RAPAHSA277276, dJ139D8.5, FLJ21198, rapa-1, rapa-2, RP1-139D8.5, transcriptional regulating factor 1, transcriptional regulating protein 132, transcriptional-regulating factor 1, Transcriptional-regulating protein 132, TReP-132, TREP132, Zinc finger protein rapa, Zinc finger transcription factor TReP-132 |
| Gene, Accession # | TRERF1, Gene ID: 55809 |
| Catalog # | NBP2-58666 |
| Price | |
| Order / More Info | TRERF1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|