| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CNOT1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CNOT1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CNOT1. This antibody reacts with human. The CNOT1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human CNOT1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: TIETLMRINAHSRGNAPEGLPQLMEVVRSNYEAMIDRAHGGPNFMMHSGISQASEYDDPPGLREKAEYLLREWVNLYHSAAAGRDSTKAFSAFVG |
|---|
| Other Names | AD-005, adrenal gland protein AD-005, CCR4-associated factor 1, CCR4-NOT transcription complex subunit 1, CCR4-NOT transcription complex, subunit 1, CDC39DKFZp686E0722, hNOT1, KIAA1007DKFZp686O168, Negative regulator of transcription subunit 1 homolog, NOT1 (negative regulator of transcription 1, yeast) homolog, NOT1FLJ90644, NOT1HFLJ36492 |
|---|
| Gene, Accession # | CNOT1, Gene ID: 23019, Accession: A5YKK6, SwissProt: A5YKK6 |
|---|
| Catalog # | NBP2-32045 |
|---|
| Price | |
|---|
| Order / More Info | CNOT1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|