| Edit |   |
|---|
| Antigenic Specificity | CNOT11 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CNOT11 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CNOT11. This antibody reacts with human. The CNOT11 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to C2ORF29 The peptide sequence was selected from the middle region of C2ORF29. Peptide sequence SVDISGLQLALAERQSELPTQSKASFPSILSDPDPDSSNSGFDSSVASQI. |
|---|
| Other Names | C2orf29, C40, chromosome 2 open reading frame 29, hypothetical protein LOC55571 |
|---|
| Gene, Accession # | C2ORF29, Gene ID: 55571, Accession: Q9UKZ1, SwissProt: Q9UKZ1 |
|---|
| Catalog # | NBP1-56529-20ul |
|---|
| Price | |
|---|
| Order / More Info | CNOT11 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|