| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Pentraxin 2/SAP |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Pentraxin 2/SAP Antibody from Novus Biologicals is a rabbit polyclonal antibody to Pentraxin 2/SAP. This antibody reacts with human. The Pentraxin 2/SAP Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Pentraxin 2/SAP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: QEQDSYGGKFDRSQSFVGEIGDLYMWDSVLPPENILSAYQGTPLPANILDWQALNYEIRGYVIIKPLVWV |
|---|
| Other Names | 9.5S alpha-1-glycoprotein, amyloid P component, serum, MGC88159, PTX2serum amyloid P-component, SAPpentaxin-related, Serum Amyloid P component |
|---|
| Gene, Accession # | APCS, Gene ID: 325, Accession: P02743, SwissProt: P02743 |
|---|
| Catalog # | NBP2-31392 |
|---|
| Price | |
|---|
| Order / More Info | Pentraxin 2/SAP Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|