| Edit |   |
|---|
| Antigenic Specificity | C-myc promoter-binding protein |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The C-myc promoter-binding protein Antibody from Novus Biologicals is a rabbit polyclonal antibody to C-myc promoter-binding protein. This antibody reacts with human. The C-myc promoter-binding protein Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human C-myc promoter-binding protein antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LDTSALSVQGNFDLNSKSKLQENFCTRSIQIPANRSKTAMSKCPIFPMARSISTSGPLDKEDTGRQKLISTGSLPATLQGATDSLGL |
|---|
| Other Names | c-myc promoter binding protein, C-myc promoter-binding protein, DENN domain-containing protein 4A, DENN/MADD domain containing 4A, IRLBFLJ33949, KIAA0476, MYCPBP |
|---|
| Gene, Accession # | DENND4A, Gene ID: 10260 |
|---|
| Catalog # | NBP2-49444 |
|---|
| Price | |
|---|
| Order / More Info | C-myc promoter-binding protein Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|