| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MMP-8 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MMP-8 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MMP-8. This antibody reacts with human. The MMP-8 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human MMP-8 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KWERTNLTYRIRNYTPQLSEAEVERAIKDAFELWSVASPLIFTRISQGEADINIAFYQRDHGDNSPFDGPNG |
|---|
| Other Names | CLG1HNC, EC 3.4.24, EC 3.4.24.34, matrix metallopeptidase 8 (neutrophil collagenase), matrix metalloproteinase 8 (neutrophil collagenase), Matrix metalloproteinase-8, MMP-8, neutrophil collagenase, PMNL collagenase, PMNL-CL |
|---|
| Gene, Accession # | MMP8, Gene ID: 4317 |
|---|
| Catalog # | NBP1-85576 |
|---|
| Price | |
|---|
| Order / More Info | MMP-8 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 25996154 |
|---|
| 产品资料 |
|
|