| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Ferric Chelate Reductase 1 Like |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Ferric Chelate Reductase 1 Like Antibody from Novus Biologicals is a rabbit polyclonal antibody to Ferric Chelate Reductase 1 Like. This antibody reacts with human. The Ferric Chelate Reductase 1 Like Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human C9orf4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RHDSSYGTFAGEFYDLRYLSEEGYPFPTAPPVDPFAKIKVDDCGKTKGCFRYGKPGCNAETC |
|---|
| Other Names | Brain protein CG-6, C9orf4, CG6, CG-6, chromosome 9 open reading frame 4, ferric-chelate reductase 1-like, hypothetical protein LOC23732 |
|---|
| Gene, Accession # | FRRS1L, Gene ID: 23732 |
|---|
| Catalog # | NBP2-58836 |
|---|
| Price | |
|---|
| Order / More Info | Ferric Chelate Reductase 1 Like Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|