| Edit |   |
| Antigenic Specificity | Ferric Chelate Reductase 1 Like |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Ferric Chelate Reductase 1 Like Antibody from Novus Biologicals is a rabbit polyclonal antibody to Ferric Chelate Reductase 1 Like. This antibody reacts with human. The Ferric Chelate Reductase 1 Like Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to C9ORF4 The peptide sequence was selected from the middle region of C9ORF4. Peptide sequence HDDNGRVRIQHFYNVGQWAKEIQRNPARDEEGVFENNRVTCRFKRPVNVP. |
| Other Names | Brain protein CG-6, C9orf4, CG6, CG-6, chromosome 9 open reading frame 4, ferric-chelate reductase 1-like, hypothetical protein LOC23732 |
| Gene, Accession # | FRRS1L, Gene ID: 23732, Accession: Q9P0K9, SwissProt: Q9P0K9 |
| Catalog # | NBP1-59960-20ul |
| Price | |
| Order / More Info | Ferric Chelate Reductase 1 Like Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |